Viewing profile — jfarlow

Network effects + energetic fficiencies. On an energy landscape that includes integration over very short and very long lifetimes, the thalweg of utility/energy rests right about w…

This is a challenge, even for someone who has professionally used the breadth of proteins. I really like the test. I'm actually kind of surprised at my own pulling on knowledge to …

And the atoms in the proteins and DNA that are exactly replicated to the atom each have a feature sizes resolved at fractions of a nanometer in 3 dimensions (and likely in time/dyn…

Here's the full sequence of the protein, found in the supplement [1] KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRI…

This is an AI-generated response, and is inaccurate. That was one of the first cases of _germline_ gene editing using CRISPR - NOT "the first instance of gene editing." There have …

"Custom" in that this therapy was designed AFTER a specific patient showed a need, and then given to _that_ patient. In most every other context a particular class of disease is kn…

It also can actually allow you to identify positions within the image at a greater resolution than the pixels, or even light itself, would otherwise allow. In microscopy, this is c…

Serotiny: https://en.wikipedia.org/wiki/Serotiny

>to build something but to not know how it actually works and yet it works. Welcome to Biology!

Clearly RAM-stingy Apple has found a use for RAM - almost certainly in loading local LLMs. Llama 8G loads and runs pretty well on the new M-series Macs with a reasonable amount of …

There are a number of companies working on 'in vivo' deliveries for CARs. Oftentimes using the same tools as proven out by the Moderna vaccine.

There are two kinds of personalization in a [CAR] [T] therapy: 1) using the patient's own cells [personalization of T Cells] 2) customized therapeutic genetic payload, per patient …

I've designed a device that utilizes mechanical force to transmit information that was around 5nm in diameter. It was based on the human Notch receptor. It's a few hundred amino ac…

Using the above chemistry, you can attach DNA oligos to lipids, DNA oligos to proteins, fluorophores to DNA, fluorophores to proteins at particular locations or other complex drugs…

Serotiny | Remote (US), Bay Area, CA | Full-Time | https://serotiny.com Serotiny invents synthetic proteins to treat cancer and genetic diseases. We have a novel approach to design…

Serotiny | Bioinformatics Scientist - Next Generation Sequencing + Protein Design | Remote (US), Bay Area, CA | https://serotiny.com/ Serotiny invents synthetic proteins to treat c…

Serotiny | Bioinformatics Scientist - Next Generation Sequencing + Protein Design | Remote (US), Bay Area, CA | https://serotiny.com/ Serotiny invents synthetic proteins to treat c…

Serotiny | Bioinformatics Scientist - Next Generation Sequencing + Protein Design | Remote (US), Bay Area, CA | https://serotiny.com/ Serotiny invents synthetic proteins to treat c…

The Base Editor (and Prime Editor, etc.) _is_ CRISPR (Cas9) but with additional components fused to it that provide it additional features allowing it to edit in a more elegant way…

The number of [nucleic-acid-delivered] gene therapies in Phase II & Phase III trials right now is huge - because of this progress in delivery [of nucleic acids]. Gene therapies for…

Delivery of the RNA is hard. To the right cell type, not immediately degraded, not accidentally integrated into a critical part of the genome, with a payload that is actually effec…

>Even the cells infected with the mRNA will need to be removed by the immune system using cytotoxic T-cells I don't think that this is accurate.

In short - certain ones, yes. This should be one step (that was a bottleneck) in helping a company with a fixed budget do an order or magnitude more 'experiments' with the same amo…

Very cool! I've actually built similar models for myself to build that intuition. They're so helpful and generally hard to find. I agree that scale is generally poorly taught. I pe…

Goodsell's book, "Machinery of Life" is fantastic at giving a first-pass representation of the basic interactions in a cell that are otherwise invisible. https://ccsb.scripps.edu/g…